Anti ZNF473 pAb (ATL-HPA073309)

Atlas Antibodies

Catalog No.:
ATL-HPA073309-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 473
Gene Name: ZNF473
Alternative Gene Name: DKFZP434N043, HZFP100, KIAA1141
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048012: 51%, ENSRNOG00000026572: 59%
Entrez Gene ID: 25888
Uniprot ID: Q8WTR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAEEFVTLKDVGMDFTLGDWEQLGLEQGDTFWDTALDNCQDLFLLDPPRPNLTSHPDGSEDLEPLAGG
Gene Sequence MAEEFVTLKDVGMDFTLGDWEQLGLEQGDTFWDTALDNCQDLFLLDPPRPNLTSHPDGSEDLEPLAGG
Gene ID - Mouse ENSMUSG00000048012
Gene ID - Rat ENSRNOG00000026572
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF473 pAb (ATL-HPA073309)
Datasheet Anti ZNF473 pAb (ATL-HPA073309) Datasheet (External Link)
Vendor Page Anti ZNF473 pAb (ATL-HPA073309) at Atlas Antibodies

Documents & Links for Anti ZNF473 pAb (ATL-HPA073309)
Datasheet Anti ZNF473 pAb (ATL-HPA073309) Datasheet (External Link)
Vendor Page Anti ZNF473 pAb (ATL-HPA073309)