Anti ZNF471 pAb (ATL-HPA066695)

Atlas Antibodies

Catalog No.:
ATL-HPA066695-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 471
Gene Name: ZNF471
Alternative Gene Name: KIAA1396, Z1971
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055150: 38%, ENSRNOG00000015322: 44%
Entrez Gene ID: 57573
Uniprot ID: Q9BX82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESIYVTQELPLKQFMYDDACMEGITSYGLECS
Gene Sequence ESIYVTQELPLKQFMYDDACMEGITSYGLECS
Gene ID - Mouse ENSMUSG00000055150
Gene ID - Rat ENSRNOG00000015322
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF471 pAb (ATL-HPA066695)
Datasheet Anti ZNF471 pAb (ATL-HPA066695) Datasheet (External Link)
Vendor Page Anti ZNF471 pAb (ATL-HPA066695) at Atlas Antibodies

Documents & Links for Anti ZNF471 pAb (ATL-HPA066695)
Datasheet Anti ZNF471 pAb (ATL-HPA066695) Datasheet (External Link)
Vendor Page Anti ZNF471 pAb (ATL-HPA066695)
Citations for Anti ZNF471 pAb (ATL-HPA066695) – 1 Found
Sun, Ran; Xiang, Tingxiu; Tang, Jun; Peng, Weiyan; Luo, Jie; Li, Lili; Qiu, Zhu; Tan, Yiqing; Ye, Lin; Zhang, Min; Ren, Guosheng; Tao, Qian. 19q13 KRAB zinc-finger protein ZNF471 activates MAPK10/JNK3 signaling but is frequently silenced by promoter CpG methylation in esophageal cancer. Theranostics. 10(5):2243-2259.  PubMed