Anti ZNF462 pAb (ATL-HPA022283)

Atlas Antibodies

Catalog No.: ATL-HPA022283-25

Protein Description: zinc finger protein 462
Gene Name: ZNF462
Alternative Gene Name: DKFZP762N2316, KIAA1803, Zfp462
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060206: 77%, ENSRNOG00000032048: 79%
Entrez Gene ID: 58499
Uniprot ID: Q96JM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HGAALNTEKRFPCEFCGRAFSQGSEWERHVLRHGMALNDTKQVSREEIHPKEIMENSVKMPSIEEKEDDEAIGIDFSLKNETVAICVVTA
• Gene Sequence: HGAALNTEKRFPCEFCGRAFSQGSEWERHVLRHGMALNDTKQVSREEIHPKEIMENSVKMPSIEEKEDDEAIGIDFSLKNETVAICVVTA
• Gene ID - Mouse: ENSMUSG00000060206
• Gene ID - Rat: ENSRNOG00000032048
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.