Anti ZNF460 pAb (ATL-HPA053004)

Atlas Antibodies

SKU:
ATL-HPA053004-25
  • Immunohistochemical staining of human pancreas shows distinct dot like cytoplasmic positivity in exocrine glandular cells and islets of Langerhans.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 460
Gene Name: ZNF460
Alternative Gene Name: HZF8, ZNF272
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039634: 28%, ENSRNOG00000006972: 29%
Entrez Gene ID: 10794
Uniprot ID: Q14592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNENCFLVQHEQILPRVKPYDC
Gene Sequence GKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNENCFLVQHEQILPRVKPYDC
Gene ID - Mouse ENSMUSG00000039634
Gene ID - Rat ENSRNOG00000006972
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF460 pAb (ATL-HPA053004)
Datasheet Anti ZNF460 pAb (ATL-HPA053004) Datasheet (External Link)
Vendor Page Anti ZNF460 pAb (ATL-HPA053004) at Atlas Antibodies

Documents & Links for Anti ZNF460 pAb (ATL-HPA053004)
Datasheet Anti ZNF460 pAb (ATL-HPA053004) Datasheet (External Link)
Vendor Page Anti ZNF460 pAb (ATL-HPA053004)