Anti ZNF446 pAb (ATL-HPA078262)

Atlas Antibodies

Catalog No.:
ATL-HPA078262-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 446
Gene Name: ZNF446
Alternative Gene Name: FLJ20626, ZKSCAN20, ZSCAN52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033961: 36%,
Entrez Gene ID: 55663
Uniprot ID: Q9NWS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QCGRGFDWKSVFVIHHRTHTSGPGVQSPGLATGESTEKPPQGEVAFPHHPRRSLTGPRSYPCEE
Gene Sequence QCGRGFDWKSVFVIHHRTHTSGPGVQSPGLATGESTEKPPQGEVAFPHHPRRSLTGPRSYPCEE
Gene ID - Mouse ENSMUSG00000033961
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF446 pAb (ATL-HPA078262)
Datasheet Anti ZNF446 pAb (ATL-HPA078262) Datasheet (External Link)
Vendor Page Anti ZNF446 pAb (ATL-HPA078262) at Atlas Antibodies

Documents & Links for Anti ZNF446 pAb (ATL-HPA078262)
Datasheet Anti ZNF446 pAb (ATL-HPA078262) Datasheet (External Link)
Vendor Page Anti ZNF446 pAb (ATL-HPA078262)