Anti ZNF445 pAb (ATL-HPA006678)

Atlas Antibodies

Catalog No.: ATL-HPA006678-25

Protein Description: zinc finger protein 445
Gene Name: ZNF445
Alternative Gene Name: ZKSCAN15, ZNF168, ZSCAN47
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047036: 50%, ENSRNOG00000025554: 47%
Entrez Gene ID: 353274
Uniprot ID: P59923
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPKGNPVAAPTGDDLQSKTNKFILNQEPLEEAETLAVSSGCPATSVSEGIGLRESFQQKSRQKDQCENPIQVRVKKEETNFSHRTGKDSEVSGSNSLDLKHVTYLRVSGRKESLKHGCGKHFRMSSHHYDYKKYGK
• Gene Sequence: QPKGNPVAAPTGDDLQSKTNKFILNQEPLEEAETLAVSSGCPATSVSEGIGLRESFQQKSRQKDQCENPIQVRVKKEETNFSHRTGKDSEVSGSNSLDLKHVTYLRVSGRKESLKHGCGKHFRMSSHHYDYKKYGK
• Gene ID - Mouse: ENSMUSG00000047036
• Gene ID - Rat: ENSRNOG00000025554
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.