Anti ZNF444 pAb (ATL-HPA065203)

Atlas Antibodies

Catalog No.:
ATL-HPA065203-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 444
Gene Name: ZNF444
Alternative Gene Name: EZF2, FLJ11137, ZSCAN17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044876: 81%, ENSRNOG00000015517: 81%
Entrez Gene ID: 55311
Uniprot ID: Q8N0Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSQAVRPYKQEPSSPPLAPGLPAFLAAPGTTSCPECGKTSLKPAHLLRHRQSHSGE
Gene Sequence DSQAVRPYKQEPSSPPLAPGLPAFLAAPGTTSCPECGKTSLKPAHLLRHRQSHSGE
Gene ID - Mouse ENSMUSG00000044876
Gene ID - Rat ENSRNOG00000015517
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF444 pAb (ATL-HPA065203)
Datasheet Anti ZNF444 pAb (ATL-HPA065203) Datasheet (External Link)
Vendor Page Anti ZNF444 pAb (ATL-HPA065203) at Atlas Antibodies

Documents & Links for Anti ZNF444 pAb (ATL-HPA065203)
Datasheet Anti ZNF444 pAb (ATL-HPA065203) Datasheet (External Link)
Vendor Page Anti ZNF444 pAb (ATL-HPA065203)