Anti ZNF444 pAb (ATL-HPA056895)

Atlas Antibodies

Catalog No.: ATL-HPA056895-25

Protein Description: zinc finger protein 444
Gene Name: ZNF444
Alternative Gene Name: EZF2, FLJ11137, ZSCAN17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044876: 64%, ENSRNOG00000015517: 64%
Entrez Gene ID: 55311
Uniprot ID: Q8N0Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEVAVPVKQEAEGLALDSPWHRFRRFHLGD
• Gene Sequence: MEVAVPVKQEAEGLALDSPWHRFRRFHLGD
• Gene ID - Mouse: ENSMUSG00000044876
• Gene ID - Rat: ENSRNOG00000015517
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.