Anti ZNF432 pAb (ATL-HPA065606)

Atlas Antibodies

Catalog No.:
ATL-HPA065606-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 432
Gene Name: ZNF432
Alternative Gene Name: KIAA0798
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034751: 27%, ENSRNOG00000024508: 31%
Entrez Gene ID: 9668
Uniprot ID: O94892
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PENNEVDDHLQDHLENQRMLKSVEQYHEHNAFGNTASQTKSLCLFRENHDT
Gene Sequence PENNEVDDHLQDHLENQRMLKSVEQYHEHNAFGNTASQTKSLCLFRENHDT
Gene ID - Mouse ENSMUSG00000034751
Gene ID - Rat ENSRNOG00000024508
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF432 pAb (ATL-HPA065606)
Datasheet Anti ZNF432 pAb (ATL-HPA065606) Datasheet (External Link)
Vendor Page Anti ZNF432 pAb (ATL-HPA065606) at Atlas Antibodies

Documents & Links for Anti ZNF432 pAb (ATL-HPA065606)
Datasheet Anti ZNF432 pAb (ATL-HPA065606) Datasheet (External Link)
Vendor Page Anti ZNF432 pAb (ATL-HPA065606)