Anti ZNF432 pAb (ATL-HPA060274)

Atlas Antibodies

Catalog No.:
ATL-HPA060274-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 432
Gene Name: ZNF432
Alternative Gene Name: KIAA0798
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052525: 32%, ENSRNOG00000043223: 36%
Entrez Gene ID: 9668
Uniprot ID: O94892
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCEINNSTKFSGDGKSFLHGNYEELYSAAKFSVSTKANSTKSQVSKHQRTHEI
Gene Sequence SCEINNSTKFSGDGKSFLHGNYEELYSAAKFSVSTKANSTKSQVSKHQRTHEI
Gene ID - Mouse ENSMUSG00000052525
Gene ID - Rat ENSRNOG00000043223
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF432 pAb (ATL-HPA060274)
Datasheet Anti ZNF432 pAb (ATL-HPA060274) Datasheet (External Link)
Vendor Page Anti ZNF432 pAb (ATL-HPA060274) at Atlas Antibodies

Documents & Links for Anti ZNF432 pAb (ATL-HPA060274)
Datasheet Anti ZNF432 pAb (ATL-HPA060274) Datasheet (External Link)
Vendor Page Anti ZNF432 pAb (ATL-HPA060274)