Anti ZNF432 pAb (ATL-HPA060274)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060274-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF432
Alternative Gene Name: KIAA0798
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052525: 32%, ENSRNOG00000043223: 36%
Entrez Gene ID: 9668
Uniprot ID: O94892
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SCEINNSTKFSGDGKSFLHGNYEELYSAAKFSVSTKANSTKSQVSKHQRTHEI |
Gene Sequence | SCEINNSTKFSGDGKSFLHGNYEELYSAAKFSVSTKANSTKSQVSKHQRTHEI |
Gene ID - Mouse | ENSMUSG00000052525 |
Gene ID - Rat | ENSRNOG00000043223 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF432 pAb (ATL-HPA060274) | |
Datasheet | Anti ZNF432 pAb (ATL-HPA060274) Datasheet (External Link) |
Vendor Page | Anti ZNF432 pAb (ATL-HPA060274) at Atlas Antibodies |
Documents & Links for Anti ZNF432 pAb (ATL-HPA060274) | |
Datasheet | Anti ZNF432 pAb (ATL-HPA060274) Datasheet (External Link) |
Vendor Page | Anti ZNF432 pAb (ATL-HPA060274) |