Anti ZNF417 pAb (ATL-HPA056213)

Atlas Antibodies

Catalog No.:
ATL-HPA056213-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 417
Gene Name: ZNF417
Alternative Gene Name: MGC34079
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045140: 38%, ENSRNOG00000018485: 34%
Entrez Gene ID: 147687
Uniprot ID: Q8TAU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KFYRKSVREASFVKKRKLRVSQEPFVFREFGK
Gene Sequence KFYRKSVREASFVKKRKLRVSQEPFVFREFGK
Gene ID - Mouse ENSMUSG00000045140
Gene ID - Rat ENSRNOG00000018485
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF417 pAb (ATL-HPA056213)
Datasheet Anti ZNF417 pAb (ATL-HPA056213) Datasheet (External Link)
Vendor Page Anti ZNF417 pAb (ATL-HPA056213) at Atlas Antibodies

Documents & Links for Anti ZNF417 pAb (ATL-HPA056213)
Datasheet Anti ZNF417 pAb (ATL-HPA056213) Datasheet (External Link)
Vendor Page Anti ZNF417 pAb (ATL-HPA056213)