Anti ZNF41 pAb (ATL-HPA069102 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA069102-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 41
Gene Name: ZNF41
Alternative Gene Name: MGC8941, MRX89
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058291: 57%, ENSRNOG00000001317: 57%
Entrez Gene ID: 7592
Uniprot ID: P51814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIHAGEKSRECDKSNKVFPQKPQVDVHPSVYTGEKPY
Gene Sequence RIHAGEKSRECDKSNKVFPQKPQVDVHPSVYTGEKPY
Gene ID - Mouse ENSMUSG00000058291
Gene ID - Rat ENSRNOG00000001317
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF41 pAb (ATL-HPA069102 w/enhanced validation)
Datasheet Anti ZNF41 pAb (ATL-HPA069102 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZNF41 pAb (ATL-HPA069102 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ZNF41 pAb (ATL-HPA069102 w/enhanced validation)
Datasheet Anti ZNF41 pAb (ATL-HPA069102 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZNF41 pAb (ATL-HPA069102 w/enhanced validation)