Anti ZNF404 pAb (ATL-HPA063607)

Atlas Antibodies

Catalog No.:
ATL-HPA063607-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 404
Gene Name: ZNF404
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020420: 29%, ENSRNOG00000001141: 28%
Entrez Gene ID: 342908
Uniprot ID: Q494X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSLDFNFTTESNKLSSEKRNYEVNAYHQETWKRNKTFNLMRFIFRTDPQYTI
Gene Sequence VSLDFNFTTESNKLSSEKRNYEVNAYHQETWKRNKTFNLMRFIFRTDPQYTI
Gene ID - Mouse ENSMUSG00000020420
Gene ID - Rat ENSRNOG00000001141
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF404 pAb (ATL-HPA063607)
Datasheet Anti ZNF404 pAb (ATL-HPA063607) Datasheet (External Link)
Vendor Page Anti ZNF404 pAb (ATL-HPA063607) at Atlas Antibodies

Documents & Links for Anti ZNF404 pAb (ATL-HPA063607)
Datasheet Anti ZNF404 pAb (ATL-HPA063607) Datasheet (External Link)
Vendor Page Anti ZNF404 pAb (ATL-HPA063607)