Anti ZNF398 pAb (ATL-HPA071533)

Atlas Antibodies

Catalog No.:
ATL-HPA071533-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 398
Gene Name: ZNF398
Alternative Gene Name: KIAA1339, P51, P71, ZER6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062519: 82%, ENSRNOG00000006703: 84%
Entrez Gene ID: 57541
Uniprot ID: Q8TD17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GRSFRYKQTLKDHLRSGHNGGCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWYG
Gene Sequence GRSFRYKQTLKDHLRSGHNGGCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWYG
Gene ID - Mouse ENSMUSG00000062519
Gene ID - Rat ENSRNOG00000006703
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF398 pAb (ATL-HPA071533)
Datasheet Anti ZNF398 pAb (ATL-HPA071533) Datasheet (External Link)
Vendor Page Anti ZNF398 pAb (ATL-HPA071533) at Atlas Antibodies

Documents & Links for Anti ZNF398 pAb (ATL-HPA071533)
Datasheet Anti ZNF398 pAb (ATL-HPA071533) Datasheet (External Link)
Vendor Page Anti ZNF398 pAb (ATL-HPA071533)