Anti ZNF398 pAb (ATL-HPA071533)

Atlas Antibodies

Catalog No.: ATL-HPA071533-25

Protein Description: zinc finger protein 398
Gene Name: ZNF398
Alternative Gene Name: KIAA1339, P51, P71, ZER6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062519: 82%, ENSRNOG00000006703: 84%
Entrez Gene ID: 57541
Uniprot ID: Q8TD17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRSFRYKQTLKDHLRSGHNGGCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWYG
• Gene Sequence: GRSFRYKQTLKDHLRSGHNGGCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWYG
• Gene ID - Mouse: ENSMUSG00000062519
• Gene ID - Rat: ENSRNOG00000006703
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.