Anti ZNF395 pAb (ATL-HPA076275)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076275-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF395
Alternative Gene Name: DKFZp434K1210, HDBP2, PBF, PRF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034522: 92%, ENSRNOG00000014191: 88%
Entrez Gene ID: 55893
Uniprot ID: Q9H8N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAA |
| Gene Sequence | WPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAA |
| Gene ID - Mouse | ENSMUSG00000034522 |
| Gene ID - Rat | ENSRNOG00000014191 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF395 pAb (ATL-HPA076275) | |
| Datasheet | Anti ZNF395 pAb (ATL-HPA076275) Datasheet (External Link) |
| Vendor Page | Anti ZNF395 pAb (ATL-HPA076275) at Atlas Antibodies |
| Documents & Links for Anti ZNF395 pAb (ATL-HPA076275) | |
| Datasheet | Anti ZNF395 pAb (ATL-HPA076275) Datasheet (External Link) |
| Vendor Page | Anti ZNF395 pAb (ATL-HPA076275) |