Anti ZNF395 pAb (ATL-HPA076275)

Atlas Antibodies

SKU: ATL-HPA076275-25

• 
• 
• 

Protein Description: zinc finger protein 395
Gene Name: ZNF395
Alternative Gene Name: DKFZp434K1210, HDBP2, PBF, PRF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034522: 92%, ENSRNOG00000014191: 88%
Entrez Gene ID: 55893
Uniprot ID: Q9H8N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAA
• Gene Sequence: WPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAA
• Gene ID - Mouse: ENSMUSG00000034522
• Gene ID - Rat: ENSRNOG00000014191
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.