Anti ZNF395 pAb (ATL-HPA076275)

Atlas Antibodies

Catalog No.:
ATL-HPA076275-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 395
Gene Name: ZNF395
Alternative Gene Name: DKFZp434K1210, HDBP2, PBF, PRF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034522: 92%, ENSRNOG00000014191: 88%
Entrez Gene ID: 55893
Uniprot ID: Q9H8N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAA
Gene Sequence WPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAA
Gene ID - Mouse ENSMUSG00000034522
Gene ID - Rat ENSRNOG00000014191
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF395 pAb (ATL-HPA076275)
Datasheet Anti ZNF395 pAb (ATL-HPA076275) Datasheet (External Link)
Vendor Page Anti ZNF395 pAb (ATL-HPA076275) at Atlas Antibodies

Documents & Links for Anti ZNF395 pAb (ATL-HPA076275)
Datasheet Anti ZNF395 pAb (ATL-HPA076275) Datasheet (External Link)
Vendor Page Anti ZNF395 pAb (ATL-HPA076275)