Anti ZNF394 pAb (ATL-HPA051421 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051421-25
  • Immunohistochemical staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ZNF394 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403147).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 394
Gene Name: ZNF394
Alternative Gene Name: FLJ12298, ZKSCAN14, ZSCAN46
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029627: 38%, ENSRNOG00000000983: 35%
Entrez Gene ID: 84124
Uniprot ID: Q53GI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGLNSISDVNKNGSIEGEDSKNNELQNSARCSNLVLCQHIPKAERPTDSEEHGNKCKQSFHMVTWHVLKPHKSD
Gene Sequence EGLNSISDVNKNGSIEGEDSKNNELQNSARCSNLVLCQHIPKAERPTDSEEHGNKCKQSFHMVTWHVLKPHKSD
Gene ID - Mouse ENSMUSG00000029627
Gene ID - Rat ENSRNOG00000000983
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ZNF394 pAb (ATL-HPA051421 w/enhanced validation)
Datasheet Anti ZNF394 pAb (ATL-HPA051421 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZNF394 pAb (ATL-HPA051421 w/enhanced validation)