Anti ZNF383 pAb (ATL-HPA063945)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063945-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF383
Alternative Gene Name: FLJ35863
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099689: 51%, ENSRNOG00000020774: 60%
Entrez Gene ID: 163087
Uniprot ID: Q8NA42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLKKEVYEIELCQREIMGLTKHGLEYSSFGDVLEYRSHLAKQLGYPNGHFSQEIF |
| Gene Sequence | SLKKEVYEIELCQREIMGLTKHGLEYSSFGDVLEYRSHLAKQLGYPNGHFSQEIF |
| Gene ID - Mouse | ENSMUSG00000099689 |
| Gene ID - Rat | ENSRNOG00000020774 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF383 pAb (ATL-HPA063945) | |
| Datasheet | Anti ZNF383 pAb (ATL-HPA063945) Datasheet (External Link) |
| Vendor Page | Anti ZNF383 pAb (ATL-HPA063945) at Atlas Antibodies |
| Documents & Links for Anti ZNF383 pAb (ATL-HPA063945) | |
| Datasheet | Anti ZNF383 pAb (ATL-HPA063945) Datasheet (External Link) |
| Vendor Page | Anti ZNF383 pAb (ATL-HPA063945) |