Anti ZNF382 pAb (ATL-HPA049259)

Atlas Antibodies

Catalog No.:
ATL-HPA049259-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 382
Gene Name: ZNF382
Alternative Gene Name: FLJ14686, KS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074220: 60%, ENSRNOG00000020777: 64%
Entrez Gene ID: 84911
Uniprot ID: Q96SR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEQPFDHNECEKSFLMKGMLFTHTRAHRGERTFEYNKDGIAFIEKSSLSVHPSNLMEKKPSAYNKYGKFLCRKPV
Gene Sequence PEQPFDHNECEKSFLMKGMLFTHTRAHRGERTFEYNKDGIAFIEKSSLSVHPSNLMEKKPSAYNKYGKFLCRKPV
Gene ID - Mouse ENSMUSG00000074220
Gene ID - Rat ENSRNOG00000020777
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF382 pAb (ATL-HPA049259)
Datasheet Anti ZNF382 pAb (ATL-HPA049259) Datasheet (External Link)
Vendor Page Anti ZNF382 pAb (ATL-HPA049259) at Atlas Antibodies

Documents & Links for Anti ZNF382 pAb (ATL-HPA049259)
Datasheet Anti ZNF382 pAb (ATL-HPA049259) Datasheet (External Link)
Vendor Page Anti ZNF382 pAb (ATL-HPA049259)
Citations for Anti ZNF382 pAb (ATL-HPA049259) – 1 Found
Pei, Lijiao; He, Xiaoqian; Li, Shuman; Sun, Ran; Xiang, Qin; Ren, Guosheng; Xiang, Tingxiu. KRAB zinc-finger protein 382 regulates epithelial-mesenchymal transition and functions as a tumor suppressor, but is silenced by CpG methylation in gastric cancer. International Journal Of Oncology. 2018;53(3):961-972.  PubMed