Anti ZNF365 pAb (ATL-HPA052446 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052446-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF365
Alternative Gene Name: KIAA0844, UAN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037855: 92%, ENSRNOG00000000638: 93%
Entrez Gene ID: 22891
Uniprot ID: Q70YC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMI |
Gene Sequence | RSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMI |
Gene ID - Mouse | ENSMUSG00000037855 |
Gene ID - Rat | ENSRNOG00000000638 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF365 pAb (ATL-HPA052446 w/enhanced validation) | |
Datasheet | Anti ZNF365 pAb (ATL-HPA052446 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ZNF365 pAb (ATL-HPA052446 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ZNF365 pAb (ATL-HPA052446 w/enhanced validation) | |
Datasheet | Anti ZNF365 pAb (ATL-HPA052446 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ZNF365 pAb (ATL-HPA052446 w/enhanced validation) |
Citations for Anti ZNF365 pAb (ATL-HPA052446 w/enhanced validation) – 1 Found |
Wang, Chan; Liu, Shuiping; Kuang, Yeye; Hu, Xiaotong; Fang, Xiao. Downregulation of ZNF365 by methylation predicts poor prognosis in patients with colorectal cancer by decreasing phospho-p53 (Ser15) expression. Oncology Letters. 2020;20(4):85. PubMed |