Anti ZNF362 pAb (ATL-HPA059239)

Atlas Antibodies

SKU: ATL-HPA059239-25

• 
• 

Protein Description: zinc finger protein 362
Gene Name: ZNF362
Alternative Gene Name: FLJ25476, lin-29, RN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028799: 98%, ENSRNOG00000043364: 98%
Entrez Gene ID: 149076
Uniprot ID: Q5T0B9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSPSGKGHSRMAEPRFNNPYFWPPPPTMPSQLDNLVLINKIKEQLMAEKIR
• Gene Sequence: SSPSGKGHSRMAEPRFNNPYFWPPPPTMPSQLDNLVLINKIKEQLMAEKIR
• Gene ID - Mouse: ENSMUSG00000028799
• Gene ID - Rat: ENSRNOG00000043364
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.