Anti ZNF362 pAb (ATL-HPA059239)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059239-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ZNF362
Alternative Gene Name: FLJ25476, lin-29, RN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028799: 98%, ENSRNOG00000043364: 98%
Entrez Gene ID: 149076
Uniprot ID: Q5T0B9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSPSGKGHSRMAEPRFNNPYFWPPPPTMPSQLDNLVLINKIKEQLMAEKIR |
Gene Sequence | SSPSGKGHSRMAEPRFNNPYFWPPPPTMPSQLDNLVLINKIKEQLMAEKIR |
Gene ID - Mouse | ENSMUSG00000028799 |
Gene ID - Rat | ENSRNOG00000043364 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF362 pAb (ATL-HPA059239) | |
Datasheet | Anti ZNF362 pAb (ATL-HPA059239) Datasheet (External Link) |
Vendor Page | Anti ZNF362 pAb (ATL-HPA059239) at Atlas Antibodies |
Documents & Links for Anti ZNF362 pAb (ATL-HPA059239) | |
Datasheet | Anti ZNF362 pAb (ATL-HPA059239) Datasheet (External Link) |
Vendor Page | Anti ZNF362 pAb (ATL-HPA059239) |