Anti ZNF358 pAb (ATL-HPA063624)

Atlas Antibodies

Catalog No.:
ATL-HPA063624-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 358
Gene Name: ZNF358
Alternative Gene Name: FLJ10390, ZFEND
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047264: 80%, ENSRNOG00000000974: 80%
Entrez Gene ID: 140467
Uniprot ID: Q9NW07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSSFDLDPDVIGPVPLILDPNSDTLSPGDPKVDPISSGLTATPQVLATSPAVLPAPASPPRPFSCPDC
Gene Sequence SSSFDLDPDVIGPVPLILDPNSDTLSPGDPKVDPISSGLTATPQVLATSPAVLPAPASPPRPFSCPDC
Gene ID - Mouse ENSMUSG00000047264
Gene ID - Rat ENSRNOG00000000974
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF358 pAb (ATL-HPA063624)
Datasheet Anti ZNF358 pAb (ATL-HPA063624) Datasheet (External Link)
Vendor Page Anti ZNF358 pAb (ATL-HPA063624) at Atlas Antibodies

Documents & Links for Anti ZNF358 pAb (ATL-HPA063624)
Datasheet Anti ZNF358 pAb (ATL-HPA063624) Datasheet (External Link)
Vendor Page Anti ZNF358 pAb (ATL-HPA063624)