Anti ZNF358 pAb (ATL-HPA063624)

Atlas Antibodies

Catalog No.: ATL-HPA063624-25

Protein Description: zinc finger protein 358
Gene Name: ZNF358
Alternative Gene Name: FLJ10390, ZFEND
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047264: 80%, ENSRNOG00000000974: 80%
Entrez Gene ID: 140467
Uniprot ID: Q9NW07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSSFDLDPDVIGPVPLILDPNSDTLSPGDPKVDPISSGLTATPQVLATSPAVLPAPASPPRPFSCPDC
• Gene Sequence: SSSFDLDPDVIGPVPLILDPNSDTLSPGDPKVDPISSGLTATPQVLATSPAVLPAPASPPRPFSCPDC
• Gene ID - Mouse: ENSMUSG00000047264
• Gene ID - Rat: ENSRNOG00000000974
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.