Anti ZNF34 pAb (ATL-HPA066805)

Atlas Antibodies

Catalog No.:
ATL-HPA066805-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 34
Gene Name: ZNF34
Alternative Gene Name: KOX32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047342: 46%, ENSRNOG00000003218: 46%
Entrez Gene ID: 80778
Uniprot ID: Q8IZ26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSRPVPDQRPHKCDICEQSFEQRSYLNNHTRVHRS
Gene Sequence LSRPVPDQRPHKCDICEQSFEQRSYLNNHTRVHRS
Gene ID - Mouse ENSMUSG00000047342
Gene ID - Rat ENSRNOG00000003218
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF34 pAb (ATL-HPA066805)
Datasheet Anti ZNF34 pAb (ATL-HPA066805) Datasheet (External Link)
Vendor Page Anti ZNF34 pAb (ATL-HPA066805) at Atlas Antibodies

Documents & Links for Anti ZNF34 pAb (ATL-HPA066805)
Datasheet Anti ZNF34 pAb (ATL-HPA066805) Datasheet (External Link)
Vendor Page Anti ZNF34 pAb (ATL-HPA066805)