Anti ZNF33A pAb (ATL-HPA056638)

Atlas Antibodies

Catalog No.:
ATL-HPA056638-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 33A
Gene Name: ZNF33A
Alternative Gene Name: FLJ23404, KIAA0065, KOX31, KOX5, ZNF11A, ZNF33, ZZAPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030145: 35%, ENSRNOG00000000599: 34%
Entrez Gene ID: 7581
Uniprot ID: Q06730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VWTADHLKERSQENQSKHLWEVVFINNEMLTKEQ
Gene Sequence VWTADHLKERSQENQSKHLWEVVFINNEMLTKEQ
Gene ID - Mouse ENSMUSG00000030145
Gene ID - Rat ENSRNOG00000000599
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF33A pAb (ATL-HPA056638)
Datasheet Anti ZNF33A pAb (ATL-HPA056638) Datasheet (External Link)
Vendor Page Anti ZNF33A pAb (ATL-HPA056638) at Atlas Antibodies

Documents & Links for Anti ZNF33A pAb (ATL-HPA056638)
Datasheet Anti ZNF33A pAb (ATL-HPA056638) Datasheet (External Link)
Vendor Page Anti ZNF33A pAb (ATL-HPA056638)