Anti ZNF335 pAb (ATL-HPA063999)

Atlas Antibodies

Catalog No.:
ATL-HPA063999-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 335
Gene Name: ZNF335
Alternative Gene Name: bA465L10.2, NIF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039834: 85%, ENSRNOG00000017290: 82%
Entrez Gene ID: 63925
Uniprot ID: Q9H4Z2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNGHLKFHIQRLHSPDGRKSGTPTARAPTQTPTQTIILNSDDETLATLHTALQSSHGVLGPERLQQALSQEHIIVAQEQ
Gene Sequence RNGHLKFHIQRLHSPDGRKSGTPTARAPTQTPTQTIILNSDDETLATLHTALQSSHGVLGPERLQQALSQEHIIVAQEQ
Gene ID - Mouse ENSMUSG00000039834
Gene ID - Rat ENSRNOG00000017290
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF335 pAb (ATL-HPA063999)
Datasheet Anti ZNF335 pAb (ATL-HPA063999) Datasheet (External Link)
Vendor Page Anti ZNF335 pAb (ATL-HPA063999) at Atlas Antibodies

Documents & Links for Anti ZNF335 pAb (ATL-HPA063999)
Datasheet Anti ZNF335 pAb (ATL-HPA063999) Datasheet (External Link)
Vendor Page Anti ZNF335 pAb (ATL-HPA063999)