Anti ZNF334 pAb (ATL-HPA050022)

Atlas Antibodies

Catalog No.:
ATL-HPA050022-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 334
Gene Name: ZNF334
Alternative Gene Name: bA179N14.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073427: 46%, ENSRNOG00000019099: 50%
Entrez Gene ID: 55713
Uniprot ID: Q9HCZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HTGEKHGVFNKCGRISIVKSNCSQCKRMNTKENLYECSEHGHAVSKNSHLIVHQ
Gene Sequence HTGEKHGVFNKCGRISIVKSNCSQCKRMNTKENLYECSEHGHAVSKNSHLIVHQ
Gene ID - Mouse ENSMUSG00000073427
Gene ID - Rat ENSRNOG00000019099
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF334 pAb (ATL-HPA050022)
Datasheet Anti ZNF334 pAb (ATL-HPA050022) Datasheet (External Link)
Vendor Page Anti ZNF334 pAb (ATL-HPA050022) at Atlas Antibodies

Documents & Links for Anti ZNF334 pAb (ATL-HPA050022)
Datasheet Anti ZNF334 pAb (ATL-HPA050022) Datasheet (External Link)
Vendor Page Anti ZNF334 pAb (ATL-HPA050022)