Anti ZNF324B pAb (ATL-HPA023400)

Atlas Antibodies

Catalog No.: ATL-HPA023400-25

Protein Description: zinc finger protein 324B
Gene Name: ZNF324B
Alternative Gene Name: FLJ45850
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005267: 43%, ENSRNOG00000003215: 43%
Entrez Gene ID: 388569
Uniprot ID: Q6AW86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPFVCTQCGRAFRERPALLHHQRIHTTEKTNAAAPDCTPGPGFLQGHHRKVRRGGKPSPVLKPAKV
• Gene Sequence: KPFVCTQCGRAFRERPALLHHQRIHTTEKTNAAAPDCTPGPGFLQGHHRKVRRGGKPSPVLKPAKV
• Gene ID - Mouse: ENSMUSG00000005267
• Gene ID - Rat: ENSRNOG00000003215
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.