Anti ZNF319 pAb (ATL-HPA052584)

Atlas Antibodies

Catalog No.:
ATL-HPA052584-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 319
Gene Name: ZNF319
Alternative Gene Name: KIAA1388, Zfp319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046556: 99%, ENSRNOG00000013460: 99%
Entrez Gene ID: 57567
Uniprot ID: Q9P2F9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KCGVCGHDLAHLSSPHEHQCLAGHDRSFQCTQCLKIFHQATDLLEHQCVQAEQKPFVCGVCKMGFSLLTSLAQHHSSHS
Gene Sequence KCGVCGHDLAHLSSPHEHQCLAGHDRSFQCTQCLKIFHQATDLLEHQCVQAEQKPFVCGVCKMGFSLLTSLAQHHSSHS
Gene ID - Mouse ENSMUSG00000046556
Gene ID - Rat ENSRNOG00000013460
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF319 pAb (ATL-HPA052584)
Datasheet Anti ZNF319 pAb (ATL-HPA052584) Datasheet (External Link)
Vendor Page Anti ZNF319 pAb (ATL-HPA052584) at Atlas Antibodies

Documents & Links for Anti ZNF319 pAb (ATL-HPA052584)
Datasheet Anti ZNF319 pAb (ATL-HPA052584) Datasheet (External Link)
Vendor Page Anti ZNF319 pAb (ATL-HPA052584)