Anti ZNF317 pAb (ATL-HPA048625)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048625-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF317
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057551: 56%, ENSRNOG00000006684: 45%
Entrez Gene ID: 57693
Uniprot ID: Q96PQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTFATSTQDSTCLQDSEFPVSSKDHSCPQNLDLFVCSGLEPHTPSVGSQESVTF |
| Gene Sequence | PTFATSTQDSTCLQDSEFPVSSKDHSCPQNLDLFVCSGLEPHTPSVGSQESVTF |
| Gene ID - Mouse | ENSMUSG00000057551 |
| Gene ID - Rat | ENSRNOG00000006684 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF317 pAb (ATL-HPA048625) | |
| Datasheet | Anti ZNF317 pAb (ATL-HPA048625) Datasheet (External Link) |
| Vendor Page | Anti ZNF317 pAb (ATL-HPA048625) at Atlas Antibodies |
| Documents & Links for Anti ZNF317 pAb (ATL-HPA048625) | |
| Datasheet | Anti ZNF317 pAb (ATL-HPA048625) Datasheet (External Link) |
| Vendor Page | Anti ZNF317 pAb (ATL-HPA048625) |