Anti ZNF311 pAb (ATL-HPA050541)

Atlas Antibodies

Catalog No.:
ATL-HPA050541-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 311
Gene Name: ZNF311
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072720: 29%, ENSRNOG00000019956: 29%
Entrez Gene ID: 282890
Uniprot ID: Q5JNZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVCVQDVKLENQWETSIREKLREEKEGSEEVTCKKGKNQKVLSKNLNPNSKHSQCNKVLIAQKLHECARC
Gene Sequence EVCVQDVKLENQWETSIREKLREEKEGSEEVTCKKGKNQKVLSKNLNPNSKHSQCNKVLIAQKLHECARC
Gene ID - Mouse ENSMUSG00000072720
Gene ID - Rat ENSRNOG00000019956
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF311 pAb (ATL-HPA050541)
Datasheet Anti ZNF311 pAb (ATL-HPA050541) Datasheet (External Link)
Vendor Page Anti ZNF311 pAb (ATL-HPA050541) at Atlas Antibodies

Documents & Links for Anti ZNF311 pAb (ATL-HPA050541)
Datasheet Anti ZNF311 pAb (ATL-HPA050541) Datasheet (External Link)
Vendor Page Anti ZNF311 pAb (ATL-HPA050541)