Anti ZNF304 pAb (ATL-HPA050531)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050531-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ZNF304
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047371: 43%, ENSRNOG00000029490: 43%
Entrez Gene ID: 57343
Uniprot ID: Q9HCX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLRQHQGDYDGQMLFSCGDEGKAFLDTFTLLDSQMTHAEVRPFRCLPCGNVFKEKS |
| Gene Sequence | SLRQHQGDYDGQMLFSCGDEGKAFLDTFTLLDSQMTHAEVRPFRCLPCGNVFKEKS |
| Gene ID - Mouse | ENSMUSG00000047371 |
| Gene ID - Rat | ENSRNOG00000029490 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF304 pAb (ATL-HPA050531) | |
| Datasheet | Anti ZNF304 pAb (ATL-HPA050531) Datasheet (External Link) |
| Vendor Page | Anti ZNF304 pAb (ATL-HPA050531) at Atlas Antibodies |
| Documents & Links for Anti ZNF304 pAb (ATL-HPA050531) | |
| Datasheet | Anti ZNF304 pAb (ATL-HPA050531) Datasheet (External Link) |
| Vendor Page | Anti ZNF304 pAb (ATL-HPA050531) |
| Citations for Anti ZNF304 pAb (ATL-HPA050531) – 1 Found |
| Ren, Li-Xin; Zeng, Bo-Wen; Zhu, Meng; Zhao, An-Ning; Shi, Bei; Zhang, Hong; Wang, Dan-Dan; Gu, Jun-Fei; Yang, Zhan. A Novel ZNF304/miR-183-5p/FOXO4 Pathway Regulates Cell Proliferation in Clear Cell Renal Carcinoma. Frontiers In Oncology. 11( 34692488):710525. PubMed |