Anti ZNF302 pAb (ATL-HPA059503)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059503-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF302
Alternative Gene Name: ZNF135L, ZNF140L, ZNF327
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027115: 30%, ENSRNOG00000053260: 28%
Entrez Gene ID: 55900
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNSPNSTVEA |
| Gene Sequence | KAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNSPNSTVEA |
| Gene ID - Mouse | ENSMUSG00000027115 |
| Gene ID - Rat | ENSRNOG00000053260 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF302 pAb (ATL-HPA059503) | |
| Datasheet | Anti ZNF302 pAb (ATL-HPA059503) Datasheet (External Link) |
| Vendor Page | Anti ZNF302 pAb (ATL-HPA059503) at Atlas Antibodies |
| Documents & Links for Anti ZNF302 pAb (ATL-HPA059503) | |
| Datasheet | Anti ZNF302 pAb (ATL-HPA059503) Datasheet (External Link) |
| Vendor Page | Anti ZNF302 pAb (ATL-HPA059503) |