Anti ZNF287 pAb (ATL-HPA029290)

Atlas Antibodies

Catalog No.:
ATL-HPA029290-25
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
ChIP-Exo-Seq composite graph for Anti-ZNF287 (HPA029290, Lot R31739) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 287
Gene Name: ZNF287
Alternative Gene Name: ZKSCAN13, ZSCAN45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005267: 63%, ENSRNOG00000003215: 71%
Entrez Gene ID: 57336
Uniprot ID: Q9HBT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTVIPILEEPWMVIKEILEGPSPEWETKAQACTPVEDMSKLTKEETHTIKLEDSYDYDDRLERRGKGGFWKIHTDERGFSLKSVLSQEYDPTEECLSKYDIYRNNFEKHSNLIVQFDTQLDNKTSVYNEGRA
Gene Sequence PTVIPILEEPWMVIKEILEGPSPEWETKAQACTPVEDMSKLTKEETHTIKLEDSYDYDDRLERRGKGGFWKIHTDERGFSLKSVLSQEYDPTEECLSKYDIYRNNFEKHSNLIVQFDTQLDNKTSVYNEGRA
Gene ID - Mouse ENSMUSG00000005267
Gene ID - Rat ENSRNOG00000003215
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF287 pAb (ATL-HPA029290)
Datasheet Anti ZNF287 pAb (ATL-HPA029290) Datasheet (External Link)
Vendor Page Anti ZNF287 pAb (ATL-HPA029290) at Atlas Antibodies

Documents & Links for Anti ZNF287 pAb (ATL-HPA029290)
Datasheet Anti ZNF287 pAb (ATL-HPA029290) Datasheet (External Link)
Vendor Page Anti ZNF287 pAb (ATL-HPA029290)
!