Anti ZNF286B pAb (ATL-HPA068125)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068125-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF286B
Alternative Gene Name: ZNF286C, ZNF286L, ZNF590
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052632: 36%, ENSRNOG00000009687: 36%
Entrez Gene ID: 729288
Uniprot ID: P0CG31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSLTLTYYRTAFLLSTENEGNLHFQCPSDVETRPQS |
| Gene Sequence | LSLTLTYYRTAFLLSTENEGNLHFQCPSDVETRPQS |
| Gene ID - Mouse | ENSMUSG00000052632 |
| Gene ID - Rat | ENSRNOG00000009687 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF286B pAb (ATL-HPA068125) | |
| Datasheet | Anti ZNF286B pAb (ATL-HPA068125) Datasheet (External Link) |
| Vendor Page | Anti ZNF286B pAb (ATL-HPA068125) at Atlas Antibodies |
| Documents & Links for Anti ZNF286B pAb (ATL-HPA068125) | |
| Datasheet | Anti ZNF286B pAb (ATL-HPA068125) Datasheet (External Link) |
| Vendor Page | Anti ZNF286B pAb (ATL-HPA068125) |