Anti ZNF286B pAb (ATL-HPA068125)

Atlas Antibodies

Catalog No.: ATL-HPA068125-25

Protein Description: zinc finger protein 286B
Gene Name: ZNF286B
Alternative Gene Name: ZNF286C, ZNF286L, ZNF590
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052632: 36%, ENSRNOG00000009687: 36%
Entrez Gene ID: 729288
Uniprot ID: P0CG31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSLTLTYYRTAFLLSTENEGNLHFQCPSDVETRPQS
• Gene Sequence: LSLTLTYYRTAFLLSTENEGNLHFQCPSDVETRPQS
• Gene ID - Mouse: ENSMUSG00000052632
• Gene ID - Rat: ENSRNOG00000009687
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.