Anti ZNF286A pAb (ATL-HPA021594)

Atlas Antibodies

Catalog No.:
ATL-HPA021594-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 286A
Gene Name: ZNF286A
Alternative Gene Name: KIAA1874, ZNF286
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047342: 76%, ENSRNOG00000003218: 80%
Entrez Gene ID: 57335
Uniprot ID: Q9HBT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETDLAEMPEKGALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGKLDPAQR
Gene Sequence ETDLAEMPEKGALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGKLDPAQR
Gene ID - Mouse ENSMUSG00000047342
Gene ID - Rat ENSRNOG00000003218
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF286A pAb (ATL-HPA021594)
Datasheet Anti ZNF286A pAb (ATL-HPA021594) Datasheet (External Link)
Vendor Page Anti ZNF286A pAb (ATL-HPA021594) at Atlas Antibodies

Documents & Links for Anti ZNF286A pAb (ATL-HPA021594)
Datasheet Anti ZNF286A pAb (ATL-HPA021594) Datasheet (External Link)
Vendor Page Anti ZNF286A pAb (ATL-HPA021594)