Anti ZNF285 pAb (ATL-HPA046100)

Atlas Antibodies

Catalog No.:
ATL-HPA046100-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 285
Gene Name: ZNF285
Alternative Gene Name: ZNF285A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090659: 29%, ENSRNOG00000037428: 26%
Entrez Gene ID: 26974
Uniprot ID: Q96NJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQVLTPESWRKANIMTEPQNSQGRYKGIYMEEKLYRRAQHDDSLSWTSCDHHESQECKGEDPGRHPSCGKNLGMKSTV
Gene Sequence TQVLTPESWRKANIMTEPQNSQGRYKGIYMEEKLYRRAQHDDSLSWTSCDHHESQECKGEDPGRHPSCGKNLGMKSTV
Gene ID - Mouse ENSMUSG00000090659
Gene ID - Rat ENSRNOG00000037428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF285 pAb (ATL-HPA046100)
Datasheet Anti ZNF285 pAb (ATL-HPA046100) Datasheet (External Link)
Vendor Page Anti ZNF285 pAb (ATL-HPA046100) at Atlas Antibodies

Documents & Links for Anti ZNF285 pAb (ATL-HPA046100)
Datasheet Anti ZNF285 pAb (ATL-HPA046100) Datasheet (External Link)
Vendor Page Anti ZNF285 pAb (ATL-HPA046100)