Anti ZNF280D pAb (ATL-HPA030233)

Atlas Antibodies

Catalog No.:
ATL-HPA030233-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 280D
Gene Name: ZNF280D
Alternative Gene Name: FLJ20086, SUHW4, ZNF634
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038535: 47%, ENSRNOG00000055631: 48%
Entrez Gene ID: 54816
Uniprot ID: Q6N043
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSCDSNIGADKVEKKKQIQHVCQEMELKMCQSSENIILSDQIKDHNSSEARFSSKNIKDLRLASDNVSIDQFLRKRHEPESVSSDVSEQGSIHLEPL
Gene Sequence VSCDSNIGADKVEKKKQIQHVCQEMELKMCQSSENIILSDQIKDHNSSEARFSSKNIKDLRLASDNVSIDQFLRKRHEPESVSSDVSEQGSIHLEPL
Gene ID - Mouse ENSMUSG00000038535
Gene ID - Rat ENSRNOG00000055631
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF280D pAb (ATL-HPA030233)
Datasheet Anti ZNF280D pAb (ATL-HPA030233) Datasheet (External Link)
Vendor Page Anti ZNF280D pAb (ATL-HPA030233) at Atlas Antibodies

Documents & Links for Anti ZNF280D pAb (ATL-HPA030233)
Datasheet Anti ZNF280D pAb (ATL-HPA030233) Datasheet (External Link)
Vendor Page Anti ZNF280D pAb (ATL-HPA030233)
Citations for Anti ZNF280D pAb (ATL-HPA030233) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed