Anti ZNF280B pAb (ATL-HPA059519)

Atlas Antibodies

SKU:
ATL-HPA059519-25
  • Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 280B
Gene Name: ZNF280B
Alternative Gene Name: 5'OY11.1, SUHW2, ZNF279, ZNF632
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049764: 51%, ENSRNOG00000052545: 47%
Entrez Gene ID: 140883
Uniprot ID: Q86YH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSPIIIEPLSKPDYRNSSPQVVPNNSSELPSPLITFTDSLHHPVSTALSVGGINESPRVSKQLSTFEVNSINPKRAKLRDGII
Gene Sequence DSPIIIEPLSKPDYRNSSPQVVPNNSSELPSPLITFTDSLHHPVSTALSVGGINESPRVSKQLSTFEVNSINPKRAKLRDGII
Gene ID - Mouse ENSMUSG00000049764
Gene ID - Rat ENSRNOG00000052545
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF280B pAb (ATL-HPA059519)
Datasheet Anti ZNF280B pAb (ATL-HPA059519) Datasheet (External Link)
Vendor Page Anti ZNF280B pAb (ATL-HPA059519) at Atlas Antibodies

Documents & Links for Anti ZNF280B pAb (ATL-HPA059519)
Datasheet Anti ZNF280B pAb (ATL-HPA059519) Datasheet (External Link)
Vendor Page Anti ZNF280B pAb (ATL-HPA059519)