Anti ZNF276 pAb (ATL-HPA021309)

Atlas Antibodies

Catalog No.: ATL-HPA021309-25

Protein Description: zinc finger protein 276
Gene Name: ZNF276
Alternative Gene Name: CENP-Z, CENPZ, MGC45417, ZADT, ZFP276, ZNF477
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001065: 88%, ENSRNOG00000016631: 89%
Entrez Gene ID: 92822
Uniprot ID: Q8N554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VKDEFSDLSEGDVLSEDENDKKQNAQSSDESFEPYPERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCEREELPTIY
• Gene Sequence: VKDEFSDLSEGDVLSEDENDKKQNAQSSDESFEPYPERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCEREELPTIY
• Gene ID - Mouse: ENSMUSG00000001065
• Gene ID - Rat: ENSRNOG00000016631
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.