Anti ZNF266 pAb (ATL-HPA054110)

Atlas Antibodies

Catalog No.:
ATL-HPA054110-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 266
Gene Name: ZNF266
Alternative Gene Name: HZF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063108: 50%, ENSRNOG00000025937: 44%
Entrez Gene ID: 10781
Uniprot ID: Q14584
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSENTFECYLYGVDFLTLHKKTSTGEQRSVFSQC
Gene Sequence NSENTFECYLYGVDFLTLHKKTSTGEQRSVFSQC
Gene ID - Mouse ENSMUSG00000063108
Gene ID - Rat ENSRNOG00000025937
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF266 pAb (ATL-HPA054110)
Datasheet Anti ZNF266 pAb (ATL-HPA054110) Datasheet (External Link)
Vendor Page Anti ZNF266 pAb (ATL-HPA054110) at Atlas Antibodies

Documents & Links for Anti ZNF266 pAb (ATL-HPA054110)
Datasheet Anti ZNF266 pAb (ATL-HPA054110) Datasheet (External Link)
Vendor Page Anti ZNF266 pAb (ATL-HPA054110)