Anti ZNF266 pAb (ATL-HPA054110)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054110-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF266
Alternative Gene Name: HZF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063108: 50%, ENSRNOG00000025937: 44%
Entrez Gene ID: 10781
Uniprot ID: Q14584
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NSENTFECYLYGVDFLTLHKKTSTGEQRSVFSQC |
| Gene Sequence | NSENTFECYLYGVDFLTLHKKTSTGEQRSVFSQC |
| Gene ID - Mouse | ENSMUSG00000063108 |
| Gene ID - Rat | ENSRNOG00000025937 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF266 pAb (ATL-HPA054110) | |
| Datasheet | Anti ZNF266 pAb (ATL-HPA054110) Datasheet (External Link) |
| Vendor Page | Anti ZNF266 pAb (ATL-HPA054110) at Atlas Antibodies |
| Documents & Links for Anti ZNF266 pAb (ATL-HPA054110) | |
| Datasheet | Anti ZNF266 pAb (ATL-HPA054110) Datasheet (External Link) |
| Vendor Page | Anti ZNF266 pAb (ATL-HPA054110) |