Anti ZNF230 pAb (ATL-HPA006172)

Atlas Antibodies

Catalog No.:
ATL-HPA006172-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 230
Gene Name: ZNF230
Alternative Gene Name: FDZF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006720: 29%, ENSRNOG00000053635: 29%
Entrez Gene ID: 7773
Uniprot ID: Q9UIE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKTIAEAGPHEDCPCQQIWEQTASDLTQSQDSIINNSHFFEQGDVPSQVEAGLSIIHTGQKPSQNGKCKQSFSDVAIFDPPQQFHSGEKS
Gene Sequence GKTIAEAGPHEDCPCQQIWEQTASDLTQSQDSIINNSHFFEQGDVPSQVEAGLSIIHTGQKPSQNGKCKQSFSDVAIFDPPQQFHSGEKS
Gene ID - Mouse ENSMUSG00000006720
Gene ID - Rat ENSRNOG00000053635
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF230 pAb (ATL-HPA006172)
Datasheet Anti ZNF230 pAb (ATL-HPA006172) Datasheet (External Link)
Vendor Page Anti ZNF230 pAb (ATL-HPA006172) at Atlas Antibodies

Documents & Links for Anti ZNF230 pAb (ATL-HPA006172)
Datasheet Anti ZNF230 pAb (ATL-HPA006172) Datasheet (External Link)
Vendor Page Anti ZNF230 pAb (ATL-HPA006172)