Anti ZNF227 pAb (ATL-HPA030573)

Atlas Antibodies

Catalog No.:
ATL-HPA030573-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 227
Gene Name: ZNF227
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096916: 28%, ENSRNOG00000010050: 33%
Entrez Gene ID: 7770
Uniprot ID: Q86WZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FWRTQHSCGNTYLSESQIQSRGKQIDVKNNLQIHEDFMKKSPFHEHIKTDTEPKPCKGNEYGKIISDGSNQKLPL
Gene Sequence FWRTQHSCGNTYLSESQIQSRGKQIDVKNNLQIHEDFMKKSPFHEHIKTDTEPKPCKGNEYGKIISDGSNQKLPL
Gene ID - Mouse ENSMUSG00000096916
Gene ID - Rat ENSRNOG00000010050
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF227 pAb (ATL-HPA030573)
Datasheet Anti ZNF227 pAb (ATL-HPA030573) Datasheet (External Link)
Vendor Page Anti ZNF227 pAb (ATL-HPA030573) at Atlas Antibodies

Documents & Links for Anti ZNF227 pAb (ATL-HPA030573)
Datasheet Anti ZNF227 pAb (ATL-HPA030573) Datasheet (External Link)
Vendor Page Anti ZNF227 pAb (ATL-HPA030573)