Anti ZNF215 pAb (ATL-HPA051010)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051010-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF215
Alternative Gene Name: ZKSCAN11, ZSCAN43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026896: 26%, ENSRNOG00000006227: 26%
Entrez Gene ID: 7762
Uniprot ID: Q9UL58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FRNLNSLRKAHLLSKPFESLKLESKKKRWIMEKEIPRKTIFDMKSISGEESSHGVIMTRLTESGHPSSDAWKGENWLYRNQ |
Gene Sequence | FRNLNSLRKAHLLSKPFESLKLESKKKRWIMEKEIPRKTIFDMKSISGEESSHGVIMTRLTESGHPSSDAWKGENWLYRNQ |
Gene ID - Mouse | ENSMUSG00000026896 |
Gene ID - Rat | ENSRNOG00000006227 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF215 pAb (ATL-HPA051010) | |
Datasheet | Anti ZNF215 pAb (ATL-HPA051010) Datasheet (External Link) |
Vendor Page | Anti ZNF215 pAb (ATL-HPA051010) at Atlas Antibodies |
Documents & Links for Anti ZNF215 pAb (ATL-HPA051010) | |
Datasheet | Anti ZNF215 pAb (ATL-HPA051010) Datasheet (External Link) |
Vendor Page | Anti ZNF215 pAb (ATL-HPA051010) |