Anti ZNF213 pAb (ATL-HPA056750)

Atlas Antibodies

Catalog No.: ATL-HPA056750-25

Protein Description: zinc finger protein 213
Gene Name: ZNF213
Alternative Gene Name: CR53, ZKSCAN21, ZSCAN53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071256: 71%, ENSRNOG00000021872: 69%
Entrez Gene ID: 7760
Uniprot ID: O14771
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACR
• Gene Sequence: PLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACR
• Gene ID - Mouse: ENSMUSG00000071256
• Gene ID - Rat: ENSRNOG00000021872
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.