Anti ZNF212 pAb (ATL-HPA054178)

Atlas Antibodies

Catalog No.:
ATL-HPA054178-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 212
Gene Name: ZNF212
Alternative Gene Name: C2H2-150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052763: 58%, ENSRNOG00000006711: 57%
Entrez Gene ID: 7988
Uniprot ID: Q9UDV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPGEFSCIAEEQAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGSRVPSSSRTVGCPKQKSHRQVQLDQECGQGLKLK
Gene Sequence LPGEFSCIAEEQAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGSRVPSSSRTVGCPKQKSHRQVQLDQECGQGLKLK
Gene ID - Mouse ENSMUSG00000052763
Gene ID - Rat ENSRNOG00000006711
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF212 pAb (ATL-HPA054178)
Datasheet Anti ZNF212 pAb (ATL-HPA054178) Datasheet (External Link)
Vendor Page Anti ZNF212 pAb (ATL-HPA054178) at Atlas Antibodies

Documents & Links for Anti ZNF212 pAb (ATL-HPA054178)
Datasheet Anti ZNF212 pAb (ATL-HPA054178) Datasheet (External Link)
Vendor Page Anti ZNF212 pAb (ATL-HPA054178)