Anti ZNF207 pAb (ATL-HPA017013 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA017013-25

Protein Description: zinc finger protein 207
Gene Name: ZNF207
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017421: 97%, ENSRNOG00000000236: 99%
Entrez Gene ID: 7756
Uniprot ID: O43670
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGP
• Gene Sequence: KPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGP
• Gene ID - Mouse: ENSMUSG00000017421
• Gene ID - Rat: ENSRNOG00000000236
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZNF207 pAb (ATL-HPA017013 w/enhanced validation) – 3 Found

Wan, Yihan; Zheng, Xiaobin; Chen, Haiyang; Guo, Yuxuan; Jiang, Hao; He, Xiaonan; Zhu, Xueliang; Zheng, Yixian. Splicing function of mitotic regulators links R-loop-mediated DNA damage to tumor cell killing. The Journal Of Cell Biology. 2015;209(2):235-46. 

Huang, Yuejia; Li, Teng; Ems-McClung, Stephanie C; Walczak, Claire E; Prigent, Claude; Zhu, Xueliang; Zhang, Xuemin; Zheng, Yixian. Aurora A activation in mitosis promoted by BuGZ. The Journal Of Cell Biology. 2018;217(1):107-116. 

Dopie, Joseph; Sweredoski, Michael J; Moradian, Annie; Belmont, Andrew S. Tyramide signal amplification mass spectrometry (TSA-MS) ratio identifies nuclear speckle proteins. The Journal Of Cell Biology. 2020;219(9)