Anti ZNF200 pAb (ATL-HPA018981)

Atlas Antibodies

Catalog No.: ATL-HPA018981-25

Protein Description: zinc finger protein 200
Gene Name: ZNF200
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024180: 30%, ENSRNOG00000020374: 31%
Entrez Gene ID: 7752
Uniprot ID: P98182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFILRVPPDSKLGQDLLRDATNGPKTIHQLVLEHFLTFLPKPSLVQPSQKVKETLVIMKDVSSSLQNRVHPRPLVKLLPKGVQK
• Gene Sequence: SFILRVPPDSKLGQDLLRDATNGPKTIHQLVLEHFLTFLPKPSLVQPSQKVKETLVIMKDVSSSLQNRVHPRPLVKLLPKGVQK
• Gene ID - Mouse: ENSMUSG00000024180
• Gene ID - Rat: ENSRNOG00000020374
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.