Anti ZNF197 pAb (ATL-HPA054567)

Atlas Antibodies

Catalog No.:
ATL-HPA054567-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 197
Gene Name: ZNF197
Alternative Gene Name: D3S1363E, P18, ZKSCAN9, ZNF166, ZSCAN41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034156: 27%, ENSRNOG00000019768: 27%
Entrez Gene ID: 10168
Uniprot ID: O14709
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTSLEWETMTENEEVTSKPSSSQRADSHKGTSKRLQGSVPQVLDFEEECEWQVLASQWGNETDERADTVKKVS
Gene Sequence VTSLEWETMTENEEVTSKPSSSQRADSHKGTSKRLQGSVPQVLDFEEECEWQVLASQWGNETDERADTVKKVS
Gene ID - Mouse ENSMUSG00000034156
Gene ID - Rat ENSRNOG00000019768
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF197 pAb (ATL-HPA054567)
Datasheet Anti ZNF197 pAb (ATL-HPA054567) Datasheet (External Link)
Vendor Page Anti ZNF197 pAb (ATL-HPA054567) at Atlas Antibodies

Documents & Links for Anti ZNF197 pAb (ATL-HPA054567)
Datasheet Anti ZNF197 pAb (ATL-HPA054567) Datasheet (External Link)
Vendor Page Anti ZNF197 pAb (ATL-HPA054567)