Anti ZNF197 pAb (ATL-HPA054567)

Atlas Antibodies

Catalog No.: ATL-HPA054567-25

Protein Description: zinc finger protein 197
Gene Name: ZNF197
Alternative Gene Name: D3S1363E, P18, ZKSCAN9, ZNF166, ZSCAN41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034156: 27%, ENSRNOG00000019768: 27%
Entrez Gene ID: 10168
Uniprot ID: O14709
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTSLEWETMTENEEVTSKPSSSQRADSHKGTSKRLQGSVPQVLDFEEECEWQVLASQWGNETDERADTVKKVS
• Gene Sequence: VTSLEWETMTENEEVTSKPSSSQRADSHKGTSKRLQGSVPQVLDFEEECEWQVLASQWGNETDERADTVKKVS
• Gene ID - Mouse: ENSMUSG00000034156
• Gene ID - Rat: ENSRNOG00000019768
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.