Anti ZNF19 pAb (ATL-HPA063685)

Atlas Antibodies

Catalog No.:
ATL-HPA063685-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 19
Gene Name: ZNF19
Alternative Gene Name: KOX12, MGC51021
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000100235: 36%, ENSRNOG00000016186: 34%
Entrez Gene ID: 7567
Uniprot ID: P17023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLPEFFTPFYW
Gene Sequence CSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLPEFFTPFYW
Gene ID - Mouse ENSMUSG00000100235
Gene ID - Rat ENSRNOG00000016186
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF19 pAb (ATL-HPA063685)
Datasheet Anti ZNF19 pAb (ATL-HPA063685) Datasheet (External Link)
Vendor Page Anti ZNF19 pAb (ATL-HPA063685) at Atlas Antibodies

Documents & Links for Anti ZNF19 pAb (ATL-HPA063685)
Datasheet Anti ZNF19 pAb (ATL-HPA063685) Datasheet (External Link)
Vendor Page Anti ZNF19 pAb (ATL-HPA063685)