Anti ZNF19 pAb (ATL-HPA063685)

Atlas Antibodies

Catalog No.: ATL-HPA063685-25

Protein Description: zinc finger protein 19
Gene Name: ZNF19
Alternative Gene Name: KOX12, MGC51021
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000100235: 36%, ENSRNOG00000016186: 34%
Entrez Gene ID: 7567
Uniprot ID: P17023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLPEFFTPFYW
• Gene Sequence: CSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLPEFFTPFYW
• Gene ID - Mouse: ENSMUSG00000100235
• Gene ID - Rat: ENSRNOG00000016186
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.