Anti ZNF182 pAb (ATL-HPA059574)

Atlas Antibodies

Catalog No.:
ATL-HPA059574-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 182
Gene Name: ZNF182
Alternative Gene Name: HHZ150, KOX14, Zfp182, ZNF21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054737: 62%, ENSRNOG00000047132: 51%
Entrez Gene ID: 7569
Uniprot ID: P17025
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YSNLVFVGQQVTKPNLILKLEVEECPAEGKIPFWNFPEVCQVDE
Gene Sequence YSNLVFVGQQVTKPNLILKLEVEECPAEGKIPFWNFPEVCQVDE
Gene ID - Mouse ENSMUSG00000054737
Gene ID - Rat ENSRNOG00000047132
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF182 pAb (ATL-HPA059574)
Datasheet Anti ZNF182 pAb (ATL-HPA059574) Datasheet (External Link)
Vendor Page Anti ZNF182 pAb (ATL-HPA059574) at Atlas Antibodies

Documents & Links for Anti ZNF182 pAb (ATL-HPA059574)
Datasheet Anti ZNF182 pAb (ATL-HPA059574) Datasheet (External Link)
Vendor Page Anti ZNF182 pAb (ATL-HPA059574)