Anti ZNF169 pAb (ATL-HPA061185)

Atlas Antibodies

Catalog No.:
ATL-HPA061185-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 169
Gene Name: ZNF169
Alternative Gene Name: MGC51961
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050954: 55%, ENSRNOG00000017092: 51%
Entrez Gene ID: 169841
Uniprot ID: Q14929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDEPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIFPSSSAGGDFQLEAPRCSSE
Gene Sequence GDEPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIFPSSSAGGDFQLEAPRCSSE
Gene ID - Mouse ENSMUSG00000050954
Gene ID - Rat ENSRNOG00000017092
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF169 pAb (ATL-HPA061185)
Datasheet Anti ZNF169 pAb (ATL-HPA061185) Datasheet (External Link)
Vendor Page Anti ZNF169 pAb (ATL-HPA061185) at Atlas Antibodies

Documents & Links for Anti ZNF169 pAb (ATL-HPA061185)
Datasheet Anti ZNF169 pAb (ATL-HPA061185) Datasheet (External Link)
Vendor Page Anti ZNF169 pAb (ATL-HPA061185)